Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CA125/MUC16 Antibody (CL2783), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $610.00

Specifications

Antigen	CA125/MUC16
Dilution	Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification	Monoclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP259024 View Documents View Product Certificates	Novus Biologicals NBP259024	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393164 View Documents View Product Certificates	Novus Biologicals NBP25902425UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CA125/MUC16 Monoclonal specifically detects CA125/MUC16 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	CA125/MUC16
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	CA-125, CA125 ovarian cancer antigen, CA125MUC-16, FLJ14303, mucin 16, cell surface associated, mucin-16, Ovarian cancer-related tumor marker CA125, Ovarian carcinoma antigen CA125
Gene Symbols	MUC16
Isotype	IgG2b
Purification Method	Protein A purified

Dilution	Immunohistochemistry-Paraffin 1:500 - 1:1000
Conjugate	Unconjugated
Host Species	Mouse
Research Discipline	Cellular Markers, Extracellular Matrix, Tumor Biomarkers
Gene Accession No.	Q8WXI7
Gene ID (Entrez)	94025
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CA125/MUC16 Antibody (CL2783), Novus Biologicals™

Specifications

Description

Specifications

Documents