Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CACHD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | CACHD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159989
|
Novus Biologicals
NBP159989 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP15998920
|
Novus Biologicals
NBP15998920UL |
20 μL | N/A | N/A | N/A | ||||
Description
CACHD1 Polyclonal specifically detects CACHD1 in Human samples. It is validated for Western Blot.Specifications
| CACHD1 | |
| Polyclonal | |
| Rabbit | |
| Q5VU97 | |
| 57685 | |
| Synthetic peptides corresponding to CACHD1(cache domain containing 1) The peptide sequence was selected from the N terminal of CACHD1. Peptide sequence HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cache domain containing 1, Cache domain-containing protein 1, KIAA1573VWFA and cache domain-containing protein 1, RP4-655E10.1, von Willebrand factor type A and cache domain containing 1, VWCD1 | |
| CACHD1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title