CACNA2D2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB433852	Novus Biologicals NBP18150125UL	25ul
NBP181501	Novus Biologicals NBP181501	0.1 mL

Description

CACNA2D2 Polyclonal specifically detects CACNA2D2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: CACNA2D2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Alias: alpha 2 delta calcium channel subunit, CACNA2D, calcium channel, voltage-dependent, alpha 2/delta subunit 2, gene 26, KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2, LUAC11.1, voltage-dependent calcium channel subunit alpha-2/delta-2
• Gene Symbols: CACNA2D2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated
• Classification: Polyclonal
• Host Species: Rabbit
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 9254
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only