CACYBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB406225	Novus Biologicals NBP18710425UL	25 μL
NBP187104	Novus Biologicals NBP187104	0.1 mL

Description

CACYBP Polyclonal specifically detects CACYBP in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CACYBP
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Accession No.: Q9HB71
• Gene ID (Entrez): 27101
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Wnt Signaling Pathway
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CacyBP, calcyclin binding protein, GIG5, hCacyBP, MGC87971, RP1-102G20.6, S100A6-binding protein, S100A6BPgrowth-inhibiting gene 5 protein, Siah-interacting protein, Siah-interacting protein (SIP), SIPcalcyclin-binding protein
• Gene Symbols: CACYBP
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only