Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calbindin D-28K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Calbindin D-28K |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Calbindin D-28K Polyclonal specifically detects Calbindin D-28K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Calbindin D-28K | |
Polyclonal | |
Rabbit | |
Neuronal Cell Markers, Neuroscience, Neurotransmission, Stem Cell Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CAB27, CALB, calbindin, calbindin 1, (28kD), calbindin 1, 28kDa, Calbindin D28, D-28K, RTVL-H protein, Vitamin D-dependent calcium-binding protein, avian-type | |
CALB1 | |
IgG | |
Affinity Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P05937 | |
793 | |
This antibody was developed against a recombinant protein corresponding to amino acids: IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title