Calcium Activated Nucleotidase 1/CANT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB431538	Novus Biologicals NBP18708225UL	25 μL
NBP187082	Novus Biologicals NBP187082	0.1 mL

Description

Calcium Activated Nucleotidase 1/CANT1 Polyclonal specifically detects Calcium Activated Nucleotidase 1/CANT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Calcium Activated Nucleotidase 1/CANT1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Apyrase homolog, calcium activated nucleotidase 1, DBQD, EC 3.6.1.6, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN1, SCAN-1Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase, SHAPYmicromelic dwarfism with vertebral and metaphyseal abnormalities and advancedcarpotarsal ossification, soluble Ca-activated nucleotidase, isozyme 1, soluble calcium-activated nucleotidase 1, soluble calcium-activated nucleotidase SCAN-1
• Gene Symbols: CANT1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Lipid and Metabolism
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 124583
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only