Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Calcium-sensing R/CaSR Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody has been used in 1 publication

$646.00

Specifications

Antigen Calcium-sensing R/CaSR
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP238622
SDP
View Documents
Novus Biologicals
NBP238622
0.1 mL
Each of 1 for $646.00
Only null left
Add to Cart
 
Description

Description

Calcium-sensing R/CaSR Polyclonal specifically detects Calcium-sensing R/CaSR in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Specifications

Specifications

Calcium-sensing R/CaSR
Polyclonal
Rabbit
Cytoskeleton Markers, Extracellular Matrix, GPCR, Growth and Development, Lipid and Metabolism, Neuroscience, Neurotransmission, Signal Transduction
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
calcium-sensing receptor, CAR, CaSR, EIG8, extracellular calcium-sensing receptor, FHH, FIH, GPRC2AHHC, HHC1, hypocalciuric hypercalcemia 1, NSHPT, parathyroid Ca(2+)-sensing receptor 1, Parathyroid cell calcium-sensing receptor, PCaR1, PCAR1MGC138441
CASR
IgG
Affinity Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
Human, Mouse
P41180
846
This antibody was developed against a recombinant protein corresponding to amino acids: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.