Calcyphosine Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158929

Catalog No. NBP158929

Description

Calcyphosine Polyclonal specifically detects Calcyphosine in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Calcyphosine
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: calcyphosin, calcyphosine, calcyphosine 1, CAPS1, MGC126562, thyroid protein p24
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Rat, Pig, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q13938
• Gene Symbols: CAPS
• Immunogen: Synthetic peptides corresponding to CAPS(calcyphosine) The peptide sequence was selected from the N terminal of CAPS. Peptide sequence DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 828
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.