Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Calcyphosine Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Calcyphosine |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Calcyphosine Polyclonal specifically detects Calcyphosine in Human samples. It is validated for Western Blot.Specifications
Calcyphosine | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
calcyphosin, calcyphosine, calcyphosine 1, CAPS1, MGC126562, thyroid protein p24 | |
CAPS | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q13938 | |
828 | |
Synthetic peptides corresponding to CAPS(calcyphosine) The peptide sequence was selected from the N terminal of CAPS. Peptide sequence DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title