Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CaMKII beta Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CaMKII beta |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CaMKII beta Polyclonal specifically detects CaMKII beta in Rat samples. It is validated for Western Blot.Specifications
CaMKII beta | |
Western Blot | |
Unconjugated | |
Rabbit | |
Protein Kinase, Wnt Signaling Pathway | |
PBS buffer, 2% sucrose | |
816 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Rat | |
calcium/calmodulin-dependent protein kinase (CaM kinase) II beta, calcium/calmodulin-dependent protein kinase II beta, calcium/calmodulin-dependent protein kinase type II beta chain, calcium/calmodulin-dependent protein kinase type II subunit beta, CaM kinase II beta subunit, CaM kinase II subunit beta, CAM2CAMK2, CAMKB, CaMK-II subunit beta, CaM-kinase II beta chain, EC 2.7.11, EC 2.7.11.17, MGC29528, proline rich calmodulin-dependent protein kinase | |
The immunogen is a synthetic peptide directed towards the middle region of Rat CaMKII beta (NP_001035813). Peptide sequence DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title