Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CaMKV Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CaMKV |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CaMKV Polyclonal specifically detects CaMKV in Human samples. It is validated for Western Blot.Specifications
CaMKV | |
Polyclonal | |
Rabbit | |
Neuronal Cell Markers, Neurotransmission | |
1G5, CaM kinase-like vesicle-associated, caM kinase-like vesicle-associated protein, MGC8407, VACAMKL, vesicle-associated calmodulin-binding protein | |
CAMKV | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q8NCB2 | |
79012 | |
Synthetic peptides corresponding to CAMKV(CaM kinase-like vesicle-associated) The peptide sequence was selected from the N terminal of CAMKV. Peptide sequence NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title