CAPC/ LRRC26 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170485

Catalog No. NBP170485

Description

CAPC / LRRC26 Polyclonal specifically detects CAPC / LRRC26 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CAPC / LRRC26
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: LRRC26
• Immunogen: Synthetic peptides corresponding to CAPC LRRC26, The peptide sequence was selected from the middle region CAPC LRRC26. Peptide sequence LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 389816
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CAPC, cytokeratin associated protein, leucine rich repeat containing 26
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig 77%, Porcine 77%, Equine 83%.
• Target Species: Human, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

For Research Use Only