Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CAPZA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CAPZA3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15641620
|
Novus Biologicals
NBP15641620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156416
|
Novus Biologicals
NBP156416 |
100 μL |
Each for $487.50
|
|
|||||
Description
CAPZA3 Polyclonal specifically detects CAPZA3 in Human samples. It is validated for Western Blot.Specifications
| CAPZA3 | |
| Polyclonal | |
| Rabbit | |
| Q96KX2 | |
| 93661 | |
| Synthetic peptides corresponding to CAPZA3(capping protein (actin filament) muscle Z-line, alpha 3) The peptide sequence was selected from the N terminal of CAPZA3. Peptide sequence MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CAPAA3, CAPPA3F-actin capping protein alpha-3 subunit, capping protein (actin filament) muscle Z-line, alpha 3, CapZ alpha-3, CP-alpha-3, F-actin-capping protein subunit alpha-3, Germ cell-specific protein 3, GSG3 | |
| CAPZA3 | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha-3. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title