Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carbohydrate Sulfotransferase 1/CHST1/KS6ST Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Carbohydrate Sulfotransferase 1/CHST1/KS6ST |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162370
|
Novus Biologicals
NBP162370 |
100 μL |
Each of 1 for $436.00
|
|
Description
Carbohydrate Sulfotransferase 1/CHST1/KS6ST Polyclonal specifically detects Carbohydrate Sulfotransferase 1/CHST1/KS6ST in Human samples. It is validated for Western Blot.Specifications
Carbohydrate Sulfotransferase 1/CHST1/KS6ST | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C6ST, carbohydrate (chondroitin 6/keratan) sulfotransferase 1, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, carbohydrate sulfotransferase 1, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, GST-1, Keratan sulfate Gal-6 sulfotransferase, KS6ST, KSGAL6ST, KSGal6STEC 2.8.2.21, KSST | |
CHST1 | |
IgG | |
Affinity Purified | |
47 kDa |
Western Blot | |
Unconjugated | |
RUO | |
O43916 | |
8534 | |
Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the middle region of CHST1. Peptide sequence YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title