Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Carbonic Anhydrase IV/CA4 Antibody, Novus Biologicals™

Carbonic Anhydrase IV/CA4 Antibody, Novus Biologicals™
SDP

Catalog No. NB418229 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418229 25 μL
NBP188225 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418229 Supplier Novus Biologicals Supplier No. NBP18822525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Carbonic Anhydrase IV/CA4 Polyclonal specifically detects Carbonic Anhydrase IV/CA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Carbonic Anhydrase IV/CA4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CAIV, CA-IV, Car4, Carbonate dehydratase IV, carbonic anhydrase 4, carbonic anhydrase IVRP17, carbonic dehydratase IV, EC 4.2.1.1, retinitis pigmentosa 17 (autosomal dominant)
Gene Symbols CA4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Vision
Primary or Secondary Primary
Gene ID (Entrez) 762
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.