Carbonic Anhydrase IV/CA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169435

Catalog No. NBP169435

Description

Carbonic Anhydrase IV/CA4 Polyclonal specifically detects Carbonic Anhydrase IV/CA4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Carbonic Anhydrase IV/CA4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CAIV, CA-IV, Car4, Carbonate dehydratase IV, carbonic anhydrase 4, carbonic anhydrase IVRP17, carbonic dehydratase IV, EC 4.2.1.1, retinitis pigmentosa 17 (autosomal dominant)
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism, Vision
• Gene ID (Entrez): 762
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: P22748
• Gene Symbols: CA4
• Immunogen: Synthetic peptides corresponding to CA4(carbonic anhydrase IV) The peptide sequence was selected from the C terminal of Carbonic Anhydrase IV. Peptide sequence AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Rat: 85%; Mouse: 85%; Equine: 83%; Bovine: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only