Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carbonic Anhydrase VIII/CA8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Carbonic Anhydrase VIII/CA8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
Carbonic Anhydrase VIII/CA8 Polyclonal specifically detects Carbonic Anhydrase VIII/CA8 in Human samples. It is validated for Western Blot.Specifications
Carbonic Anhydrase VIII/CA8 | |
Polyclonal | |
Purified | |
RUO | |
P35219 | |
767 | |
Synthetic peptides corresponding to CA8(carbonic anhydrase VIII) The peptide sequence was selected from the N terminal of CA8. Peptide sequence YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC. | |
Primary | |
32 kDa |
Western Blot | |
Unconjugated | |
Rabbit | |
Lipid and Metabolism | |
CALScarbonate dehydratase, CAMRQ3, carbonic anhydrase VIIIMGC99509, carbonic anhydrase-like sequence, carbonic anhydrase-related protein, CARPCA-related protein, CA-VIII, MGC120502 | |
CA8 | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title