Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carbonic Anhydrase XII/CA12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $728.30
Specifications
| Antigen | Carbonic Anhydrase XII/CA12 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Carbonic Anhydrase XII/CA12 Polyclonal specifically detects Carbonic Anhydrase XII/CA12 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Carbonic Anhydrase XII/CA12 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Carbonate dehydratase XII, carbonic anhydrase 12, carbonic anhydrase XIICAXII, carbonic dehydratase, CA-XII, EC 4.2.1.1, FLJ20151, HsT18816, Tumor antigen HOM-RCC-3.1.3 | |
| CA12 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 771 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title