Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carboxylesterase 1/CES1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | Carboxylesterase 1/CES1 |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Carboxylesterase 1/CES1 Polyclonal antibody specifically detects Carboxylesterase 1/CES1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
Carboxylesterase 1/CES1 | |
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cancer, Cardiovascular Biology, CD Markers, Endocrinology, Immunology, Signal Transduction | |
PBS (pH 7.2), 40% Glycerol | |
1066 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
ACAT, acyl coenzyme A:cholesterol acyltransferase, Acyl-coenzyme A:cholesterol acyltransferase, Brain carboxylesterase hBr1, carboxylesterase 1, carboxylesterase 1 (monocyte/macrophage serine esterase 1), carboxylesterase 2 (liver), CEH, Ces-1, CES1A2, CES2EC 3.1.1.1, cholesteryl ester hydrolase, Cocaine carboxylesterase, EC 3.1.1, egasyn, HMSE1, HMSECES1A1, human monocyte/macrophage serine esterase 1, liver carboxylesterase 1, MGC117365, Monocyte/macrophage serine esterase, PCE-1, REH, Retinyl ester hydrolase, Serine esterase 1, Ses-1, SES1TGH, Triacylglycerol hydrolase | |
This antibody was developed against a recombinant protein corresponding to amino acids: HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title