Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Carboxypeptidase A1/CPA1 Antibody (CL6607), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $610.00

Specifications

Antigen	Carboxypeptidase A1/CPA1
Clone	CL6607
Classification	Monoclonal
Conjugate	Unconjugated
Host Species	Mouse

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB435191 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP27650725UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP276507 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP276507	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Carboxypeptidase A1/CPA1 Monoclonal specifically detects Carboxypeptidase A1/CPA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Carboxypeptidase A1/CPA1
Classification	Monoclonal
Host Species	Mouse
Gene Alias	carboxypeptidase A1, carboxypeptidase A1 (pancreatic), CPA, EC 3.4.17, EC 3.4.17.1
Gene Symbols	CPA1
Isotype	IgG2b
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Clone	CL6607
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene ID (Entrez)	1357
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Carboxypeptidase A1/CPA1 Antibody (CL6607), Novus Biologicals™

Specifications

Description

Specifications

Documents