Invitrogen™ Carboxypeptidase A1 Polyclonal Antibody

Catalog No.	Quantity
PIPA579062	100 μg

Catalog No. PIPA579062 Supplier Invitrogen™ Supplier No. PA579062

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat pancreas tissue, mouse pancreas tissue.

CPA1, also known as CPA, is a 419 amino acid secreted monomeric protein that is highly expressed in pancreatic tissue. Functioning as a pancreatic exopeptidase, CPA1 uses zinc as a cofactor to catalyze the release of C-terminal amino acids from a variety of proteins, thereby playing a key role in protein digestion and degradation. Via its catalytic activity, CPA1 is also thought to be involved in zymogen (proenzyme) inhibition, probably functioning to block enzyme activation pathways. Abnormal levels of CPA1 are associated with pancreatic cancer, suggesting a possible role in either tumor progression or tumor suppression events.

Specifications

• Antigen: Carboxypeptidase A1
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: Cpa1
• Gene Accession No.: P00731, P15085, Q7TPZ8
• Gene Alias: 0910001L12Rik; carboxypeptidase A; carboxypeptidase A1; carboxypeptidase A1 (pancreatic); carboxypeptidase A1, pancreatic; CPA; Cpa1; pancreatic carboxypeptidase A; pancreatic procarboxypeptidase A
• Gene Symbols: Cpa1
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 109697, 1357, 24269
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG