Carboxypeptidase B2/CPB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15792020UL

Catalog No. NBP15792020

Description

Carboxypeptidase B2/CPB2 Polyclonal specifically detects Carboxypeptidase B2/CPB2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Carboxypeptidase B2/CPB2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q96IY4
• Gene Symbols: CPB2
• Immunogen: Synthetic peptides corresponding to CPB2(carboxypeptidase B2 (plasma)) The peptide sequence was selected from the middle region of CPB2. Peptide sequence RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: carboxypeptidase B2, carboxypeptidase B2 (plasma), carboxypeptidase B2 (plasma, carboxypeptidase U), Carboxypeptidase U, CPUEC 3.4.17.20, EC 3.4.17, PCPB, Plasma carboxypeptidase B, TAFIcarboxypeptidase B-like protein, Thrombin-activable fibrinolysis inhibitor, thrombin-activatable fibrinolysis inhibitor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1361
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.