Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Carboxypeptidase B2/CPB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Carboxypeptidase B2/CPB2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157920
|
Novus Biologicals
NBP157920 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP15792020
|
Novus Biologicals
NBP15792020UL |
20 μL | N/A | N/A | N/A | ||||
Description
Carboxypeptidase B2/CPB2 Polyclonal specifically detects Carboxypeptidase B2/CPB2 in Human samples. It is validated for Western Blot.Specifications
| Carboxypeptidase B2/CPB2 | |
| Polyclonal | |
| Rabbit | |
| Q96IY4 | |
| 1361 | |
| Synthetic peptides corresponding to CPB2(carboxypeptidase B2 (plasma)) The peptide sequence was selected from the middle region of CPB2. Peptide sequence RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| carboxypeptidase B2, carboxypeptidase B2 (plasma), carboxypeptidase B2 (plasma, carboxypeptidase U), Carboxypeptidase U, CPUEC 3.4.17.20, EC 3.4.17, PCPB, Plasma carboxypeptidase B, TAFIcarboxypeptidase B-like protein, Thrombin-activable fibrinolysis inhibitor, thrombin-activatable fibrinolysis inhibitor | |
| CPB2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title