Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Carboxypeptidase B2/CPB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00


Antigen Carboxypeptidase B2/CPB2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
20 μL
Each for $152.22
Add to cart
View Documents
Novus Biologicals
100 μL
Each for $436.00
Add to cart


Carboxypeptidase B2/CPB2 Polyclonal specifically detects Carboxypeptidase B2/CPB2 in Human samples. It is validated for Western Blot.


Carboxypeptidase B2/CPB2
Synthetic peptides corresponding to CPB2(carboxypeptidase B2 (plasma)) The peptide sequence was selected from the middle region of CPB2. Peptide sequence RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
carboxypeptidase B2, carboxypeptidase B2 (plasma), carboxypeptidase B2 (plasma, carboxypeptidase U), Carboxypeptidase U, CPUEC, EC 3.4.17, PCPB, Plasma carboxypeptidase B, TAFIcarboxypeptidase B-like protein, Thrombin-activable fibrinolysis inhibitor, thrombin-activatable fibrinolysis inhibitor
Affinity Purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit