Carm1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP321326100UL

Catalog No. NB239916

Description

Carm1 Polyclonal antibody specifically detects Carm1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Carm1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: coactivator-associated arginine methyltransferase 1EC 2.1.1.-, EC 2.1.1, histone-arginine methyltransferase CARM1, PRMT4EC 2.1.1.125, Protein arginine N-methyltransferase 4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS
• Quantity: 100 μg
• Research Discipline: Cancer, Cellular Markers, Phospho Specific, Transcription Factors and Regulators, Tumor Suppressors
• Gene ID (Entrez): 10498
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified