Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CART1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31055825UL
Description
CART1 Polyclonal specifically detects CART1 in Mouse samples. It is validated for Western Blot.Specifications
CART1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ALX homeobox 1, CART-1, CART1ALX homeobox protein 1, Cartilage homeoprotein 1, cartilage paired-class homeoprotein 1, FND3 | |
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_766141). Peptide sequence MEFLSEKFALKSPPSKNSDFYMGTGGALEHVMETLDNESFYGKATAGKCV | |
25 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
8092 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction