Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Casein Kinase 2 beta Rabbit anti-Human, Mouse, Rat, Clone: 9T5J10, Novus Biologicals™

Rabbit Monoclonal Antibody

$205.50 - $492.50

Specifications

Antigen	Casein Kinase 2 beta
Clone	9T5J10
Dilution	Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
Applications	Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Monoclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB167620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31626420UL	20 μg	Each for $205.50	Only null left	Sign In or Register to check your price. Add to Cart

NB167619 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP316264100UL	100 μg	Each for $492.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

Casein Kinase 2 beta Monoclonal antibody specifically detects Casein Kinase 2 beta in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen	Casein Kinase 2 beta
Dilution	Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	casein kinase 2, beta polypeptide, Casein kinase II beta subunit, casein kinase II subunit beta, CK II beta, CK2B, CSK2B, G5A, MGC138222, MGC138224, phosvitin, Protein G5a
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (P67870). YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Clone	9T5J10
Applications	Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cancer, Cell Cycle and Replication, Wnt Signaling Pathway
Formulation	PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez)	1460
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Casein Kinase 2 beta Rabbit anti-Human, Mouse, Rat, Clone: 9T5J10, Novus Biologicals™

Specifications

Description

Specifications

Documents