Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Caspase-12 Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP335067AF700
Description
Caspase-12 Polyclonal antibody specifically detects Caspase-12 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Specifications
Caspase-12 | |
Polyclonal | |
50mM Sodium Borate | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
Alexa Fluor 700 | |
Apoptosis Related Cysteine Protease, CASP 12, casp12, CASP12P1, Caspase 12 pseudogene 1, Caspase12, UNQ9415 | |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2).,, Sequence:, FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS | |
0.1 mL | |
Apoptosis, Cancer, Caspases | |
100506742 | |
Store at 4°C in the dark. | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction