Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Caspase 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Caspase 5 |
---|---|
Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Caspase 5 Polyclonal specifically detects Caspase 5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Caspase 5 | |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
P51878 | |
838 | |
This antibody was developed against Recombinant Protein corresponding to amino acids 8 - 86 of human Caspase-5: VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Caspases | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CASP-5, caspase 5, apoptosis-related cysteine peptidase, caspase 5, apoptosis-related cysteine protease, caspase-5, EC 3.4.22, EC 3.4.22.58, ICE(rel)III, ICE(rel)-III, ICEREL-III, ICH3, ICH-3, MGC141966, Protease ICH-3, Protease TY, TY protease | |
CASP5 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title