Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Caspr1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15925120UL
Description
Caspr1 Polyclonal specifically detects Caspr1 in Human, Goat samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Caspr1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P78357 | |
CNTNAP1 | |
Synthetic peptides corresponding to CNTNAP1(contactin associated protein 1) The peptide sequence was selected from the N terminal of CNTNAP1. Peptide sequence LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Caspr, Caspr1, CASPRcaspr1, CNTNAP, contactin associated protein 1, neurexin 4, Neurexin IV, Neurexin-4, NRXN4contactin-associated protein 1, P190 | |
Rabbit | |
Affinity Purified | |
RUO | |
8506 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction