Caspr1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159251

Catalog No. NBP159251

Description

Caspr1 Polyclonal specifically detects Caspr1 in Human, Goat samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Caspr1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Caspr, Caspr1, CASPRcaspr1, CNTNAP, contactin associated protein 1, neurexin 4, Neurexin IV, Neurexin-4, NRXN4contactin-associated protein 1, P190
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8506
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: P78357
• Gene Symbols: CNTNAP1
• Immunogen: Synthetic peptides corresponding to CNTNAP1(contactin associated protein 1) The peptide sequence was selected from the N terminal of CNTNAP1. Peptide sequence LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Goat, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG