Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cathepsin A/Lysosomal Carboxypeptidase A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32135525UL
Description
Cathepsin A/Lysosomal Carboxypeptidase A Polyclonal antibody specifically detects Cathepsin A/Lysosomal Carboxypeptidase A in Human samples. It is validated for Western BlotSpecifications
| Cathepsin A/Lysosomal Carboxypeptidase A | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL | |
| beta-galactosidase 2, beta-galactosidase protective protein, Carboxypeptidase C, Carboxypeptidase L, cathepsin ANGBE, EC 3.4.16, EC 3.4.16.5, GLB2, GSL, lysosomal protective protein, PPCA, PPGBprotective protein for beta-galactosidase (galactosialidosis), Protective protein cathepsin A, Protective protein for beta-galactosidase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT | |
| 25 μL | |
| Signal Transduction | |
| 5476 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction