Cathepsin C/DPPI Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310659100UL

Catalog No. NB126219

Description

Cathepsin C/DPPI Polyclonal specifically detects Cathepsin C/DPPI in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cathepsin C/DPPI
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: cathepsin CEC 3.4.14.1, Cathepsin J, CPPIHMS, dipeptidyl peptidase 1, Dipeptidyl peptidase I, Dipeptidyl transferase, dipeptidyl-peptidase I, DPP1, DPPI, DPP-I, JP, JPD, PALS, PLS
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human Cathepsin C/DPPI. Peptide sequence VNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGD
• Quantity: 100 μg
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 1075
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified