Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CBE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $646.00
Specifications
Antigen | CBE1 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CBE1 Polyclonal specifically detects CBE1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CBE1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
84688 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: KYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLN | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Human | |
bA573M23.4, C9orf24, CBE1, chromosome 9 open reading frame 24, ciliated bronchial epithelium 1, MGC32921, MGC33614, NYD-SP22, SMRP1, testes development-related NYD-SP22, Testis development protein NYD-SP22 | |
C9ORF24 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title