Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CBR4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CBR4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179860
|
Novus Biologicals
NBP179860 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CBR4 Polyclonal specifically detects CBR4 in Human samples. It is validated for Western Blot.Specifications
| CBR4 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| NP_116172 | |
| 84869 | |
| Synthetic peptide directed towards the N terminal of human CBR4The immunogen for this antibody is CBR4. Peptide sequence RKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 3-oxoacyl-[acyl-carrier-protein] reductase, carbonic reductase 4, carbonyl reductase 4, carbonyl reductase family member 4, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.100, FLJ14431, Quinone reductase CBR4, SDR45C1, short chain dehydrogenase/reductase family 45C, member 1 | |
| CBR4 | |
| IgG | |
| Affinity Purified | |
| 25 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title