Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CC2D1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15284120UL
Description
CC2D1B Polyclonal specifically detects CC2D1B in Human samples. It is validated for Western Blot.Specifications
CC2D1B | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q5T0F9 | |
CC2D1B | |
Synthetic peptides corresponding to CC2D1B(coiled-coil and C2 domain containing 1B) The peptide sequence was selected from the C terminal of CC2D1B. Peptide sequence IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF. | |
Affinity Purified | |
RUO | |
200014 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
coiled-coil and C2 domain containing 1B, KIAA1836coiled-coil and C2 domain-containing protein 1B | |
Rabbit | |
41 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction