Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CC2D1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | CC2D1B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP152841
|
Novus Biologicals
NBP152841 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP1528420
|
Novus Biologicals
NBP15284120UL |
20 μL | N/A | N/A | N/A | ||||
Description
CC2D1B Polyclonal specifically detects CC2D1B in Human samples. It is validated for Western Blot.Specifications
| CC2D1B | |
| Polyclonal | |
| Rabbit | |
| Q5T0F9 | |
| 200014 | |
| Synthetic peptides corresponding to CC2D1B(coiled-coil and C2 domain containing 1B) The peptide sequence was selected from the C terminal of CC2D1B. Peptide sequence IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| coiled-coil and C2 domain containing 1B, KIAA1836coiled-coil and C2 domain-containing protein 1B | |
| CC2D1B | |
| IgG | |
| 41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title