Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ccd1/DIXDC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP324708
Description
Ccd1/DIXDC1 Polyclonal antibody specifically detects Ccd1/DIXDC1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Ccd1/DIXDC1 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
CCD1, Coiled-coil protein DIX1, Coiled-coil-DIX1, DIX domain containing 1, DIX domain-containing protein 1, dixin, KIAA1735coiled-coil-DIX1 | |
This antibody has been engineered to specifically recognize the recombinant protein Ccd1/DIXDC1 using the following amino acid sequence: KKQERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALD | |
100 μL | |
Signal Transduction | |
85458 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction