Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC104 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen CCDC104
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB429434
SDP
View Documents
Novus Biologicals
NBP19351325UL
25 μL
Each for $382.00
Only null left
Add to Cart
 
NBP193513
SDP
View Documents
Novus Biologicals
NBP193513
0.1 mL
Each for $610.00
Only null left
Add to Cart
 
Description

Description

CCDC104 Polyclonal specifically detects CCDC104 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

CCDC104
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
112942
This antibody was developed against Recombinant Protein corresponding to amino acids:VHSSEAAIMNNSQGDGEHFAHPPSEVKMHFANQSIEPLGRKVERSETSSLPQKGLKIPGLEHASIEGPIANLSVLGTEELRQREHYLKQKRDKLMSMRKDMRTKQIQNMEQKGKPTGE
Primary
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:200-1:500
Polyclonal
Rabbit
Human, Mouse, Rat
coiled-coil domain containing 104, coiled-coil domain-containing protein 104
CCDC104
IgG
Affinity Purified
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Videos
SDS
Documents

Documents

Product Certifications

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.