Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC172 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCDC172 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCDC172 Polyclonal specifically detects CCDC172 in Human samples. It is validated for Western Blot.Specifications
CCDC172 | |
Polyclonal | |
Rabbit | |
P0C7W6 | |
374355 | |
Synthetic peptides corresponding to CCDC172 The peptide sequence was selected from the middle region of CCDC172. Peptide sequence QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C10orf96, chromosome 10 open reading frame 96, hypothetical protein LOC374355, MGC35062 | |
CCDC172 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title