Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    CCDC181 Rabbit anti-Human, Polyclonal, Novus Biologicals™
 
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310643100UL
Description
CCDC181 Polyclonal specifically detects CCDC181 in Human samples. It is validated for Western Blot.Specifications
| CCDC181 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| C1orf114, chromosome 1 open reading frame 114, RP1-206D15.2 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human CC181. Peptide sequence SPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRY | |
| 100 μg | |
| Primary | |
| Human | |
| Purified | 
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 57821 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            Spot an opportunity for improvement?Share a Content Correction
            