Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	CCDC19
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP157843 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157843	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

CCDC19 Polyclonal specifically detects CCDC19 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CCDC19
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q5VU18
Gene ID (Entrez)	25790
Immunogen	Synthetic peptides corresponding to CCDC19(coiled-coil domain containing 19) The peptide sequence was selected from the N terminal of CCDC19. Peptide sequence MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	coiled-coil domain containing 19, coiled-coil domain-containing protein 19, mitochondrial, nasopharyngeal epithelium specific protein 1 (NESG1), NESG1Nasopharyngeal epithelium-specific protein 1
Gene Symbols	CCDC19
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CCDC19 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents