Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC46 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
Antigen | CCDC46 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml |
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CCDC46 Polyclonal specifically detects CCDC46 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CCDC46 | |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
201134 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
Polyclonal | |
Rabbit | |
Human | |
coiled-coil domain containing 46, coiled-coil domain-containing protein 46, FLJ39610, MGC33887 | |
CEP112 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title