Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC46 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | CCDC46 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179545
|
Novus Biologicals
NBP179545 |
100 μL |
Each for $436.00
|
|
NBP17954520
|
Novus Biologicals
NBP17954520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
CCDC46 Polyclonal specifically detects CCDC46 in Human samples. It is validated for Western Blot.Specifications
CCDC46 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
coiled-coil domain containing 46, coiled-coil domain-containing protein 46, FLJ39610, MGC33887 | |
CEP112 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_001032402 | |
201134 | |
Synthetic peptide directed towards the C terminal of human CCDC46The immunogen for this antibody is CCDC46. Peptide sequence IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title