Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC46 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCDC46 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCDC46 Polyclonal specifically detects CCDC46 in Human samples. It is validated for Western Blot.Specifications
CCDC46 | |
Polyclonal | |
Rabbit | |
NP_001032402 | |
201134 | |
Synthetic peptide directed towards the C terminal of human CCDC46The immunogen for this antibody is CCDC46. Peptide sequence IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
coiled-coil domain containing 46, coiled-coil domain-containing protein 46, FLJ39610, MGC33887 | |
CEP112 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title