Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCDC54 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCDC54 Polyclonal specifically detects CCDC54 in Human samples. It is validated for Western Blot.Specifications
CCDC54 | |
Polyclonal | |
Rabbit | |
Human | |
coiled-coil domain containing 54, coiled-coil domain-containing protein 54, FLJ25362, NYD-SP17, testes development-related NYD-SP17, Testis development protein NYD-SP17 | |
CCDC54 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q8NEL0 | |
84692 | |
Synthetic peptides corresponding to CCDC54(coiled-coil domain containing 54) The peptide sequence was selected from the N terminal of CCDC54. Peptide sequence MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title