Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC69 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCDC69 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCDC69 Polyclonal specifically detects CCDC69 in Human samples. It is validated for Western Blot.Specifications
CCDC69 | |
Polyclonal | |
Rabbit | |
A6NI79 | |
26112 | |
Synthetic peptides corresponding to CCDC69(coiled-coil domain containing 69) The peptide sequence was selected from the middle region of CCDC69. Peptide sequence TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
coiled-coil domain containing 69, coiled-coil domain-containing protein 69, DKFZP434C171, FLJ13705 | |
CCDC69 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title