Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC70 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCDC70 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCDC70 Polyclonal specifically detects CCDC70 in Human samples. It is validated for Western Blot.Specifications
CCDC70 | |
Polyclonal | |
Rabbit | |
Q6NSX1 | |
83446 | |
Synthetic peptides corresponding to CCDC70(coiled-coil domain containing 70) The peptide sequence was selected from the middle region of CCDC70. Peptide sequence TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
coiled-coil domain containing 70, coiled-coil domain-containing protein 70, DKFZP434K1172, FLJ25853 | |
CCDC70 | |
IgG | |
26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title