Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC74B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen CCDC74B
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124141
View Documents
Novus Biologicals
NBP309620100UL
100 μg
Each for $320.71
Add to cart
 
NB124142
View Documents
Novus Biologicals
NBP30962025UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

CCDC74B Polyclonal antibody specifically detects CCDC74B in Human samples. It is validated for Western Blot
Specifications

Specifications

CCDC74B
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
91409
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
coiled-coil domain containing 74B, coiled-coil domain-containing protein 74B, DKFZp434E2321
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC74B (NP_997193). Peptide sequence QHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDGPSGNHLSRASAP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit