CCDC81 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191764

Catalog No. NBP191764

Description

CCDC81 Polyclonal specifically detects CCDC81 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCDC81
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: coiled-coil domain containing 81, coiled-coil domain-containing protein 81
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 60494
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CCDC81
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SEPIFGKNEGELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQRTQREHLADRTAELERVNRVNQCLQEDWERSA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only