Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC88B Antibody, Novus Biologicals™
SDP

Catalog No. p-200041770 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB418152 25 μL
NBP188350 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB418152 Supplier Novus Biologicals Supplier No. NBP18835025UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CCDC88B Polyclonal specifically detects CCDC88B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CCDC88B
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 78 kDa glucose-regulated protein GRP78-interacting protein induced by ER stress, brain leucine zipper domain-containing protein, brain leucine zipper protein, CCDC88, coiled-coil domain containing 88B, coiled-coil domain-containing protein 88B, gipie, HKRP3, hook-related protein 3
Gene Symbols CCDC88B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESLASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 283234
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.